Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAC2, Human (His)

The RAC2 protein is a plasma membrane-associated small GTPase that dynamically regulates cellular responses by cycling between an active GTP-bound state and an inactive GDP-bound state. In its active state, RAC2 regulates secretory function, phagocytosis, and epithelial cell polarization. RAC2 Protein, Human (His) is the recombinant human-derived RAC2 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

RAC2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rac2-protein-human-his.html

Purity

98.0

Smiles

MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQPTRQQKRAC

Molecular Formula

5880 (Gene_ID) P15153 (M1-C189) (Accession)

Molecular Weight

Approximately 25 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

PE/Fire™ 700 anti-mouse CX3CR1
GT05119 100 µg

PE/Fire™ 700 anti-mouse CX3CR1

Ask
View Details
LUM (Lumican, LDC, Keratan Sulfate Proteoglycan Lumican, KSPG Lumican, SLRR2D) (MaxLight 490) discontinued
L6025-ML490 100 µL

LUM (Lumican, LDC, Keratan Sulfate Proteoglycan Lumican, KSPG Lumican, SLRR2D) (MaxLight 490) discontinued

Ask
View Details
PIM1 (Pim-1 Oncogene, OTTHUMP00000018046, Oncogene PIM1, Non-specific serine/threonine Protein Kinase, Pim-1 Kinase 44kD isoform, Pim-1 Oncogene (proviral integration site 1), PIM)
207839 100 µg

PIM1 (Pim-1 Oncogene, OTTHUMP00000018046, Oncogene PIM1, Non-specific serine/threonine Protein Kinase, Pim-1 Kinase 44kD isoform, Pim-1 Oncogene (proviral integration site 1), PIM)

Ask
View Details
Montelukast acyl-b-D-glucuronide acetic acid salt
294092-01 1 mg

Montelukast acyl-b-D-glucuronide acetic acid salt

Ask
View Details
Montelukast acyl-b-D-glucuronide acetic acid salt
294092-02 2 mg

Montelukast acyl-b-D-glucuronide acetic acid salt

Ask
View Details
Montelukast acyl-b-D-glucuronide acetic acid salt
294092-03 5 mg

Montelukast acyl-b-D-glucuronide acetic acid salt

Ask
View Details