Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RAC2, Human (His)

The RAC2 protein is a plasma membrane-associated small GTPase that dynamically regulates cellular responses by cycling between an active GTP-bound state and an inactive GDP-bound state. In its active state, RAC2 regulates secretory function, phagocytosis, and epithelial cell polarization. RAC2 Protein, Human (His) is the recombinant human-derived RAC2 protein, expressed by E. coli , with N-His labeled tag.

Product Specifications

Product Name Alternative

RAC2 Protein, Human (His), Human, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/rac2-protein-human-his.html

Purity

98.0

Smiles

MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQPTRQQKRAC

Molecular Formula

5880 (Gene_ID) P15153 (M1-C189) (Accession)

Molecular Weight

Approximately 25 kDa

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTH (Adrenocorticotrophic Hormone) (AH26), CF740 conjugate, 0.1mg/mL
BNC740026-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF488A conjugate, 0.1mg/mL
BNC880861-500 1x 500 µL

HSP27 (G3.1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF568 conjugate, 0.1mg/mL
BNC680253-500 1x 500 µL

Cytokeratin, LMW (AE-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF647 conjugate, 0.1mg/mL
BNC471037-500 1x 500 µL

CD44 Standard (DF1485), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF594 conjugate, 0.1mg/mL
BNC940039-500 1x 500 µL

CD34 (ICO-115), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF594 conjugate, 0.1mg/mL
BNC940193-500 1x 500 µL

CD86 (BU63), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details