Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SELENOI Rabbit Polyclonal Antibody (FITC)

SELENOI Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Ept1, Seli, RGD1560938

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Seli

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FMLLVFNFLLLTYFDPDFYASAPGHKHVPDWVWIVVGILNFVAYTLDGVD

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001128226

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

INPP4B (NM_001101669) Human Recombinant Protein
TP319612 20 µg

INPP4B (NM_001101669) Human Recombinant Protein

Sign In for Pricing
View Details
Laminin 5 (LAMB3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI9G3]
TA805986BM 100 µL

Laminin 5 (LAMB3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI9G3]

Sign In for Pricing
View Details
LITAF Mouse Monoclonal Antibody [Clone ID: AT5C10]
AM09081PU-N 100 µL

LITAF Mouse Monoclonal Antibody [Clone ID: AT5C10]

Sign In for Pricing
View Details
Kyat1 Mouse Gene Knockout Kit (CRISPR)
KN502624 1 Kit

Kyat1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MYBPC2 Mouse Monoclonal Antibody [Clone ID: OTI2E1]
CF811203 100 µg

MYBPC2 Mouse Monoclonal Antibody [Clone ID: OTI2E1]

Sign In for Pricing
View Details
HS3ST6 (NM_001009606) Human Over-expression Lysate
LY422922 100 µg

HS3ST6 (NM_001009606) Human Over-expression Lysate

Sign In for Pricing
View Details