Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SELENOI Rabbit Polyclonal Antibody (HRP)

SELENOI Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Ept1, Seli, RGD1560938

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Seli

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: FMLLVFNFLLLTYFDPDFYASAPGHKHVPDWVWIVVGILNFVAYTLDGVD

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

43kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001128226

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PNMT Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4F1]
TA502856AM 100 µL

PNMT Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4F1]

Sign In for Pricing
View Details
HCG-beta (Pregnancy & Choriocarcinoma Marker) (rHCGb/54), CF405S conjugate, 0.1mg/mL
BNC042197-500 1x 500 µL

HCG-beta (Pregnancy & Choriocarcinoma Marker) (rHCGb/54), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Isoflavone
TRC-I816808-250MG 250 mg

Isoflavone

Sign In for Pricing
View Details
tert-Butyl Isopropyl Ether
TRC-B692450-500MG 500 mg

tert-Butyl Isopropyl Ether

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS704411 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
Tissue FFPE Sections, Skin
CS807100 5x 5 µm

Tissue FFPE Sections, Skin

Sign In for Pricing
View Details