Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GALNT13 Rabbit Polyclonal Antibody (Biotin)

GALNT13 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

GalNAc-T13

UniProt

Q8IUC8

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GALNT13

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: CNKCDDKKERSLLPALRAVISRNQEGPGEMGKAVLIPKDDQEKMKELFKI

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

64kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_443149

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse SLIT-ROBO Rho GTPase-activating protein 2 (Srgap2) , partial
MBS1455081 Inquire

Recombinant Mouse SLIT-ROBO Rho GTPase-activating protein 2 (Srgap2) , partial

Sign In for Pricing
View Details
RNF139 (E3 Ubiquitin-Protein Ligase RNF139, 632-, RING Finger Protein 139, Translocation in renal Carcinoma on Chromosome 8 Protein, RNF139) (MaxLight 490)
MBS6458819-01 0.1 mL

RNF139 (E3 Ubiquitin-Protein Ligase RNF139, 632-, RING Finger Protein 139, Translocation in renal Carcinoma on Chromosome 8 Protein, RNF139) (MaxLight 490)

Sign In for Pricing
View Details
RNF139 (E3 Ubiquitin-Protein Ligase RNF139, 632-, RING Finger Protein 139, Translocation in renal Carcinoma on Chromosome 8 Protein, RNF139) (MaxLight 490)
MBS6458819-02 5x 0.1 mL

RNF139 (E3 Ubiquitin-Protein Ligase RNF139, 632-, RING Finger Protein 139, Translocation in renal Carcinoma on Chromosome 8 Protein, RNF139) (MaxLight 490)

Sign In for Pricing
View Details
HOXC5 sgRNA CRISPR Lentivector (Human) (Target 3)
K0983204 1.0 µg DNA

HOXC5 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
MYO7B 3'UTR Lenti-reporter-Luc Vector
31302081 1.0 µg

MYO7B 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
SLP76 (LCP2) (NM_005565) Human Tagged ORF Clone Lentiviral Particle
RC204404L1V 200 µL

SLP76 (LCP2) (NM_005565) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details