Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLAMF6 Rabbit Polyclonal Antibody (HRP)

SLAMF6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

KALI, NTBA, CD352, KALIb, Ly108, NTB-A, SF2000

UniProt

B2R8X8

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SLAMF6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYT

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_443163

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HRAS (HRAS1, GTPase HRas, H-Ras-1, Ha-Ras, Transforming Protein p21, c-H-ras, p21ras, GTPase HRas, N-terminally Processed) (Biotin)
217440-Biotin 100 µL

HRAS (HRAS1, GTPase HRas, H-Ras-1, Ha-Ras, Transforming Protein p21, c-H-ras, p21ras, GTPase HRas, N-terminally Processed) (Biotin)

Sign In for Pricing
View Details
Enhanced Reactive Oxygen Species (ROS) Assay Kit
BC00010-01 1 Each

Enhanced Reactive Oxygen Species (ROS) Assay Kit

Sign In for Pricing
View Details
Enhanced Reactive Oxygen Species (ROS) Assay Kit
BC00010-02 100 Tests

Enhanced Reactive Oxygen Species (ROS) Assay Kit

Sign In for Pricing
View Details
Human BD-2 ELISA Kit
NP-E10022-01 1 Each

Human BD-2 ELISA Kit

Sign In for Pricing
View Details
Human BD-2 ELISA Kit
NP-E10022-02 1 Each

Human BD-2 ELISA Kit

Sign In for Pricing
View Details
Recombinant Human CD26/DPP4 protein, His Tag
MBS1562893-01 0.05 mg

Recombinant Human CD26/DPP4 protein, His Tag

Sign In for Pricing
View Details