Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLAMF6 Rabbit Polyclonal Antibody (HRP)

SLAMF6 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

KALI, NTBA, CD352, KALIb, Ly108, NTB-A, SF2000

UniProt

B2R8X8

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SLAMF6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EIHVTNPKQGKRLNFTQSYSLQLSNLKMEDTGSYRAQISTKTSAKLSSYT

Field of Research

Immunology & Inflammation

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_443163

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Catenin delta-1 (CTNND1) ELISA Kit
MBS7237308-01 48 Well

Goat Catenin delta-1 (CTNND1) ELISA Kit

Sign In for Pricing
View Details
Goat Catenin delta-1 (CTNND1) ELISA Kit
MBS7237308-02 96 Well

Goat Catenin delta-1 (CTNND1) ELISA Kit

Sign In for Pricing
View Details
Goat Catenin delta-1 (CTNND1) ELISA Kit
MBS7237308-03 5x 96 Well

Goat Catenin delta-1 (CTNND1) ELISA Kit

Sign In for Pricing
View Details
Goat Catenin delta-1 (CTNND1) ELISA Kit
MBS7237308-04 10x 96 Well

Goat Catenin delta-1 (CTNND1) ELISA Kit

Sign In for Pricing
View Details
EIF5A (Eukaryotic Translation Initiation Factor 5A-1, eIF-5A-1, eIF-5A1, Eukaryotic Initiation Factor 5A Isoform 1, eIF-5A, eIF-4D, Rev-binding Factor) (MaxLight 550)
126255-ML550 100 µL

EIF5A (Eukaryotic Translation Initiation Factor 5A-1, eIF-5A-1, eIF-5A1, Eukaryotic Initiation Factor 5A Isoform 1, eIF-5A, eIF-4D, Rev-binding Factor) (MaxLight 550)

Sign In for Pricing
View Details
KT3-Tag Mouse Monoclonal Antibody (AP)
orb969617 100 µL

KT3-Tag Mouse Monoclonal Antibody (AP)

Sign In for Pricing
View Details