Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Antxr2 Rabbit Polyclonal Antibody (Biotin)

Antxr2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

CMG2, cI-3, CMG-2, cI-35, AW561899, 2310046B19Rik

UniProt

Q6DFX2

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: GLVPSYAENEAKKSRSLGASVYCVGVLDFEQAQLERIADSKDQVFPVKGG

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

53kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_598499

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMSH (STAMBP) (NM_006463) Human Recombinant Protein
TP309475 20 µg

AMSH (STAMBP) (NM_006463) Human Recombinant Protein

Sign In for Pricing
View Details
Human monoclonal antibody to SARS-CoV-2 S1 RBD, clone 36A7
R1-164-100-01 100 µg

Human monoclonal antibody to SARS-CoV-2 S1 RBD, clone 36A7

Sign In for Pricing
View Details
Human monoclonal antibody to SARS-CoV-2 S1 RBD, clone 36A7
R1-164-100-02 500 µg

Human monoclonal antibody to SARS-CoV-2 S1 RBD, clone 36A7

Sign In for Pricing
View Details
Human monoclonal antibody to SARS-CoV-2 S1 RBD, clone 36A7
R1-164-100-03 1 mg

Human monoclonal antibody to SARS-CoV-2 S1 RBD, clone 36A7

Sign In for Pricing
View Details
PSF2/GINS2 Rabbit Polyclonal Antibody (Biotin)
orb2581136 100 µg

PSF2/GINS2 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
MK 0893
VJB82312-01 1 mg

MK 0893

Sign In for Pricing
View Details