Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Pigu Rabbit Polyclonal Antibody (FITC)

Pigu Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Cdc91l, Cdc91l1, BC028278, 5430426F17Rik

UniProt

Q3TAA8

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: PLALVLVVAVTVRAALFRSSLAEFISERVEVVSPLSSWKRVVEGLALLDL

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001004721

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmem241 Mouse Gene Knockout Kit (CRISPR)
KN517827 1 Kit

Tmem241 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TRITC Conjugated Sheep Affinity Purified Antibody to Mouse IgG
RAF-611-1 1 mL

TRITC Conjugated Sheep Affinity Purified Antibody to Mouse IgG

Sign In for Pricing
View Details
RASGRF2 Human Gene Knockout Kit (CRISPR)
KN423580 1 Kit

RASGRF2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Mouse IL-23A Protein (Fc Tag)
PDMM100097-01 20 µg

Recombinant Mouse IL-23A Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse IL-23A Protein (Fc Tag)
PDMM100097-02 100 µg

Recombinant Mouse IL-23A Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Mouse IL-23A Protein (Fc Tag)
PDMM100097-03 500 µg

Recombinant Mouse IL-23A Protein (Fc Tag)

Sign In for Pricing
View Details