Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B3gat2 Rabbit Polyclonal Antibody (Biotin)

B3gat2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

GlcA, Glcats, GlcAT-S

UniProt

P59270

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Mouse

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: SDFLKQITTVEELEPKASNCTKVLVWHTRTEKVNLANEPKYHLDTVNIEV

Field of Research

Signal Transduction

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

37kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_742122

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prpg1 sgRNA CRISPR Lentivector (Rat) (Target 2)
K7313903 1.0 µg DNA

Prpg1 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
CEL (Carboxyl Ester Lipase, BAL, FAP, BSDL, BSSL, CELL, FAPP, LIPA, CEase, MODY8) (MaxLight 650)
MBS6411214-01 0.1 mL

CEL (Carboxyl Ester Lipase, BAL, FAP, BSDL, BSSL, CELL, FAPP, LIPA, CEase, MODY8) (MaxLight 650)

Sign In for Pricing
View Details
CEL (Carboxyl Ester Lipase, BAL, FAP, BSDL, BSSL, CELL, FAPP, LIPA, CEase, MODY8) (MaxLight 650)
MBS6411214-02 5x 0.1 mL

CEL (Carboxyl Ester Lipase, BAL, FAP, BSDL, BSSL, CELL, FAPP, LIPA, CEase, MODY8) (MaxLight 650)

Sign In for Pricing
View Details
Fenfluramine Impurity 12
RM-F140912-01 10 mg

Fenfluramine Impurity 12

Sign In for Pricing
View Details
Fenfluramine Impurity 12
RM-F140912-02 25 mg

Fenfluramine Impurity 12

Sign In for Pricing
View Details
Fenfluramine Impurity 12
RM-F140912-03 50 mg

Fenfluramine Impurity 12

Sign In for Pricing
View Details