Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMC2 Rabbit Polyclonal Antibody (HRP)

TMC2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C20orf145

UniProt

Q8TDI7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TMC2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: YCWCWDLEAGFPSYAEFDISGNVLGLIFNQGMIWMGSFYAPGLVGINVLR

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

102kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_542789

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MCP-1 ELISA Kit, 2 x 96-well (pre-coated)
EA101856 2x 96 Well (Pre-Coated)

Human MCP-1 ELISA Kit, 2 x 96-well (pre-coated)

Sign In for Pricing
View Details
Sheep Activating Transcription Factor 6 ELISA Kit
MBS042589-01 48 Well

Sheep Activating Transcription Factor 6 ELISA Kit

Sign In for Pricing
View Details
Sheep Activating Transcription Factor 6 ELISA Kit
MBS042589-02 96 Well

Sheep Activating Transcription Factor 6 ELISA Kit

Sign In for Pricing
View Details
Sheep Activating Transcription Factor 6 ELISA Kit
MBS042589-03 5x 96 Well

Sheep Activating Transcription Factor 6 ELISA Kit

Sign In for Pricing
View Details
Sheep Activating Transcription Factor 6 ELISA Kit
MBS042589-04 10x 96 Well

Sheep Activating Transcription Factor 6 ELISA Kit

Sign In for Pricing
View Details
Recombinant Pig Leptin receptor gene-related protein (LEPROT)
MBS7018281-01 0.02 mg

Recombinant Pig Leptin receptor gene-related protein (LEPROT)

Sign In for Pricing
View Details