Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ITLN2 Rabbit Polyclonal Antibody (HRP)

ITLN2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HL2, HL-2

UniProt

Q8WWU7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ITLN2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TVGDRWSSQQGNKADYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_543154

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CD98 Antibody (UM7F8) [PE/Atto594]
NBP2-34506PEATT594 0.1 mL

Mouse Monoclonal CD98 Antibody (UM7F8) [PE/Atto594]

Sign In for Pricing
View Details
Atp6v1a siRNA Oligos set (Rat)
12786176 3x 5 nmol

Atp6v1a siRNA Oligos set (Rat)

Sign In for Pricing
View Details
GTPBP1 Antibody - C-terminal region
MBS3222240-01 0.1 mL

GTPBP1 Antibody - C-terminal region

Sign In for Pricing
View Details
GTPBP1 Antibody - C-terminal region
MBS3222240-02 5x 0.1 mL

GTPBP1 Antibody - C-terminal region

Sign In for Pricing
View Details
Mouse Monoclonal CD74 Antibody (SPM523) [DyLight 550]
NBP2-34778R 0.1 mL

Mouse Monoclonal CD74 Antibody (SPM523) [DyLight 550]

Sign In for Pricing
View Details
Xrcc5 Rat Pre-designed siRNA Set A
HY-RS29438 1 Set

Xrcc5 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details