Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ITLN2 Rabbit Polyclonal Antibody (HRP)

ITLN2 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

HL2, HL-2

UniProt

Q8WWU7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ITLN2

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TVGDRWSSQQGNKADYPEGDGNWANYNTFGSAEAATSDDYKNPGYYDIQA

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_543154

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ptgs2 (NM_017232) Rat Tagged Lenti ORF Clone
RR209251L3 10 µg

Ptgs2 (NM_017232) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mapk8ip3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3259507 1.0 µg DNA

Mapk8ip3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Anti-STAT4 Antibody Picoband®, APC Conjugate
PA1692-APC 100 µg/Vial

Anti-STAT4 Antibody Picoband®, APC Conjugate

Sign In for Pricing
View Details
Cdc25C Polyclonal Antibody, RBITC Conjugated
bs-10579R-RBITC 100 µL

Cdc25C Polyclonal Antibody, RBITC Conjugated

Sign In for Pricing
View Details
Bordetella pertussis Toxin discontinued discontinued
B2558-55 50 µg

Bordetella pertussis Toxin discontinued discontinued

Sign In for Pricing
View Details
KRTAP5-10 ORF Vector (Human) (pORF)
ORF022550 1.0 µg DNA

KRTAP5-10 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details