Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EMID1 Rabbit Polyclonal Antibody (HRP)

EMID1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

EMI5, EMU1

UniProt

Q96A84

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human EMID1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: TMIGLYEPELGSGAGPAGTGTPSLLRGKRGGHATNYRIVAPRSRDERG

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_597712

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

NGAL (LCN2) (NM_005564) Human Recombinant Protein
TP762367 50 µg

NGAL (LCN2) (NM_005564) Human Recombinant Protein

Sign In for Pricing
View Details
SHROOM4 AAV siRNA Pooled Vector
43737161 1.0 µg

SHROOM4 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Mouse Anti-human CD11c/PE antibody
SLM-30301M-PE-01 25 Tests

Mouse Anti-human CD11c/PE antibody

Sign In for Pricing
View Details
Mouse Anti-human CD11c/PE antibody
SLM-30301M-PE-02 50 Tests

Mouse Anti-human CD11c/PE antibody

Sign In for Pricing
View Details
Mouse Anti-human CD11c/PE antibody
SLM-30301M-PE-03 100 Tests

Mouse Anti-human CD11c/PE antibody

Sign In for Pricing
View Details
KRT81 (Keratin, Type II Cuticular Hb1, Hair Keratin K2.9, Keratin, Hair, Basic, 1, Keratin-81, K81, Metastatic Lymph Node 137 Gene Protein, MLN 137, Type II Hair Keratin Hb1, Type-II Keratin Kb21, ghHKb1, ghHb1, KRTHB1, MLN137)
MBS645063-01 0.1 mg

KRT81 (Keratin, Type II Cuticular Hb1, Hair Keratin K2.9, Keratin, Hair, Basic, 1, Keratin-81, K81, Metastatic Lymph Node 137 Gene Protein, MLN 137, Type II Hair Keratin Hb1, Type-II Keratin Kb21, ghHKb1, ghHb1, KRTHB1, MLN137)

Sign In for Pricing
View Details