Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPOPL Rabbit Polyclonal Antibody (Biotin)

SPOPL Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

BTBD33

UniProt

Q6IQ16

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human SPOPL

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: WNSNQATDIMETSGWKSMIQSHPHLVAEAFRALASAQCPQFGIPRKRLKQ

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001001664

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse 4930453N24Rik shRNA (UAS) - Lentiviral mouse 4930453N24Rik shRNA (UAS, RFP) (100)
GTR15287880 1 Vial

Lentiviral mouse 4930453N24Rik shRNA (UAS) - Lentiviral mouse 4930453N24Rik shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
CD7 Protein (C-His, Human)
P502222 100 µg

CD7 Protein (C-His, Human)

Sign In for Pricing
View Details
MKX, NT (MKX, C10orf48, IRXL1, Homeobox protein Mohawk) (AP)
MBS6321031-01 0.2 mL

MKX, NT (MKX, C10orf48, IRXL1, Homeobox protein Mohawk) (AP)

Sign In for Pricing
View Details
MKX, NT (MKX, C10orf48, IRXL1, Homeobox protein Mohawk) (AP)
MBS6321031-02 5x 0.2 mL

MKX, NT (MKX, C10orf48, IRXL1, Homeobox protein Mohawk) (AP)

Sign In for Pricing
View Details
MT2 (Metallothionein 2) BioAssayTM ELISA Kit (Human) discontinued
383751 96 Tests

MT2 (Metallothionein 2) BioAssayTM ELISA Kit (Human) discontinued

Sign In for Pricing
View Details
SFMBT1 (Scm-like with Four MBT Domains Protein 1, SFMBT, Renal Ubiquitous Protein 1, RU1) (MaxLight 490)
MBS6203244-01 0.1 mL

SFMBT1 (Scm-like with Four MBT Domains Protein 1, SFMBT, Renal Ubiquitous Protein 1, RU1) (MaxLight 490)

Sign In for Pricing
View Details