Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LIN28B Rabbit Polyclonal Antibody (FITC)

LIN28B Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

CSDD2

UniProt

Q6ZN17

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human LN28B

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GCTSPPFPQEARAEISERSGRSPQEASSTKSSIAPEEQSKKGPSVQKRKK

Purification

Affinity purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep

Tested Applications

WB

NCBI Accession Number

NP_001004317

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPS27P18 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV784806 1.0 µg DNA

RPS27P18 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details
Human Tau Mouse Monoclonal Antibody
orb1291586-01 1 Each

Human Tau Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Human Tau Mouse Monoclonal Antibody
orb1291586-02 100 µg

Human Tau Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Porimin (Keratinocytes-associated Transmembrane Protein 3, KCT-3, Pro-oncosis Receptor Inducing Membrane Injury, Transmembrane Protein 123, TMEM123, KCT3, PSEC0111, UNQ641/PRO1271) (Biotin)
131616-Biotin 100 µL

Porimin (Keratinocytes-associated Transmembrane Protein 3, KCT-3, Pro-oncosis Receptor Inducing Membrane Injury, Transmembrane Protein 123, TMEM123, KCT3, PSEC0111, UNQ641/PRO1271) (Biotin)

Sign In for Pricing
View Details
Non-printed, non-assembled Screw Cap Tube, Self-Standing, PP, 0.5 mL, Sterile, with EPDM ring Cap, Yellow, DNase/RNase free - 1000 un. - ABDOS
P10226Y 1000 Units/Pack

Non-printed, non-assembled Screw Cap Tube, Self-Standing, PP, 0.5 mL, Sterile, with EPDM ring Cap, Yellow, DNase/RNase free - 1000 un. - ABDOS

Sign In for Pricing
View Details
5- (Dimethoxymethyl) -2-fluorobenzaldehyde
JNA01914-01 0.5 g

5- (Dimethoxymethyl) -2-fluorobenzaldehyde

Sign In for Pricing
View Details