Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TCEAL8 Rabbit Polyclonal Antibody (Biotin)

TCEAL8 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

WEX3

UniProt

Q8IYN2

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TCEAL8

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PQPSEEGVSQEAEGNPRGGPNQPGQGFKEDTPVRHLDPEEMIRGVDELER

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

13kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001006685

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vascular Endothelial Growth Factor A (VEGFA) BioAssayTM ELISA Kit (Porcine)
028833 96 Tests

Vascular Endothelial Growth Factor A (VEGFA) BioAssayTM ELISA Kit (Porcine)

Sign In for Pricing
View Details
RARA, CT (RARA, NR1B1, Retinoic acid receptor alpha, Nuclear receptor subfamily 1 group B member 1) (MaxLight 405) discontinued
040836-ML405 100 µL

RARA, CT (RARA, NR1B1, Retinoic acid receptor alpha, Nuclear receptor subfamily 1 group B member 1) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Monoclonal Antibody to Tumor Necrosis Factor Receptor Superfamily, Member 7 (TNFRSF7)
TRV-0035318-01 20 µL

Monoclonal Antibody to Tumor Necrosis Factor Receptor Superfamily, Member 7 (TNFRSF7)

Sign In for Pricing
View Details
Monoclonal Antibody to Tumor Necrosis Factor Receptor Superfamily, Member 7 (TNFRSF7)
TRV-0035318-02 100 µL

Monoclonal Antibody to Tumor Necrosis Factor Receptor Superfamily, Member 7 (TNFRSF7)

Sign In for Pricing
View Details
Monoclonal Antibody to Tumor Necrosis Factor Receptor Superfamily, Member 7 (TNFRSF7)
TRV-0035318-03 200 µL

Monoclonal Antibody to Tumor Necrosis Factor Receptor Superfamily, Member 7 (TNFRSF7)

Sign In for Pricing
View Details
Monoclonal Antibody to Tumor Necrosis Factor Receptor Superfamily, Member 7 (TNFRSF7)
TRV-0035318-04 1 mL

Monoclonal Antibody to Tumor Necrosis Factor Receptor Superfamily, Member 7 (TNFRSF7)

Sign In for Pricing
View Details