Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF134 Rabbit Polyclonal Antibody (FITC)

ZNF134 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

PHZ-15

UniProt

P52741

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human ZNF134

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: TLVQHQRIHSGEKPYECSECGKAFSRKATLVQHQRIHTGERPYECSECGK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

38kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Coiled-coil domain-containing protein 147 (CCDC147) ELISA Kit
MBS7202775-01 48 Well

Chicken Coiled-coil domain-containing protein 147 (CCDC147) ELISA Kit

Sign In for Pricing
View Details
Chicken Coiled-coil domain-containing protein 147 (CCDC147) ELISA Kit
MBS7202775-02 96 Well

Chicken Coiled-coil domain-containing protein 147 (CCDC147) ELISA Kit

Sign In for Pricing
View Details
Chicken Coiled-coil domain-containing protein 147 (CCDC147) ELISA Kit
MBS7202775-03 5x 96 Well

Chicken Coiled-coil domain-containing protein 147 (CCDC147) ELISA Kit

Sign In for Pricing
View Details
Chicken Coiled-coil domain-containing protein 147 (CCDC147) ELISA Kit
MBS7202775-04 10x 96 Well

Chicken Coiled-coil domain-containing protein 147 (CCDC147) ELISA Kit

Sign In for Pricing
View Details
MTND1P18 Protein Vector (Human) (pPB-N-His)
PV102155 500 ng

MTND1P18 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Lentiviral human TAAR5 shRNA (UAS) - Lentiviral human TAAR5 shRNA (UAS, iRFP) (25)
GTR15133274 1 Vial

Lentiviral human TAAR5 shRNA (UAS) - Lentiviral human TAAR5 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details