Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

VEGF165, Human (HEK293, C-His)

VEGF165 Protein is a subtype of Vascular Endothelial Growth Factor A (VEGF-A) . VEGF-A is a key member of the VEGF family of cytokines that can promote neovascularization and increase vascular permeability. VEGF165 Protein, Human (HEK293, C-His) is the recombinant human-derived VEGF165 protein, expressed by HEK293 , with C-10*His labeled tag. The total length of VEGF165 Protein, Human (HEK293, C-His) is 165 a.a., with molecular weight of 20-23 kDa.

Product Specifications

Product Name Alternative

VEGF165 Protein, Human (HEK293, C-His), Human, HEK293

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/vegf165-protein-human-165a-a-hek293-c-his.html

Purity

95.0

Smiles

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Molecular Formula

7422 (Gene_ID) P15692-4 (A27-R191) (Accession)

Molecular Weight

Approximately 20-25 kDa, based on SDS-PAGE under reducing conditions.

References & Citations

[1]Vempati P, et al. Extracellular regulation of VEGF: isoforms, proteolysis, and vascular patterning. Cytokine Growth Factor Rev. 2014 Feb;25 (1) :1-19.|[2]Murphy JF, et al. Vascular endothelial growth factor induces cyclooxygenase-dependent proliferation of endothelial cells via the VEGF-2 receptor. FASEB J. 2001 Jul;15 (9) :1667-9.|[3]Dixelius J, et al. Minimal active domain and mechanism of action of the angiogenesis inhibitor histidine-rich glycoprotein. Cancer Res. 2006 Feb 15;66 (4) :2089-97.|[4]Glorioso N, et al. Association of ATP1A1 and dear single-nucleotide polymorphism haplotypes with essential hypertension: sex-specific and haplotype-specific effects. Circ Res. 2007 May 25;100 (10) :1522-9.|[5]Khayati F, et al. EMMPRIN/CD147 is a novel coreceptor of VEGFR-2 mediating its activation by VEGF. Oncotarget. 2015;6 (12) :9766-80.|[6]Ferrara N, et al. Molecular and biological properties of the vascular endothelial growth factor family of proteins[J]. Endocrine reviews, 1992, 13 (1) : 18-32.|[7]Ferrara N, et al. Molecular and biological properties of the vascular endothelial growth factor family of proteins. Endocr Rev. 1992 Feb;13 (1) :18-32.|[8]Terman BI, et al. Identification of the KDR tyrosine kinase as a receptor for vascular endothelial cell growth factor. Biochem Biophys Res Commun. 1992 Sep 30;187 (3) :1579-86.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse RUFY3 siRNA
abx932280-01 15 nmol

Mouse RUFY3 siRNA

Sign In for Pricing
View Details
Mouse RUFY3 siRNA
abx932280-02 30 nmol

Mouse RUFY3 siRNA

Sign In for Pricing
View Details
RNGTT Protein Vector (Mouse) (pPB-C-His)
PV224962 500 ng

RNGTT Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
MKI67IP, CT (MKI67IP, NIFK, NOPP34, MKI67 FHA domain-interacting nucleolar phosphoprotein, Nucleolar phosphoprotein Nopp34, Nucleolar protein interacting with the FHA domain of pKI-67) (MaxLight 490) discontinued
038447-ML490 100 µL

MKI67IP, CT (MKI67IP, NIFK, NOPP34, MKI67 FHA domain-interacting nucleolar phosphoprotein, Nucleolar phosphoprotein Nopp34, Nucleolar protein interacting with the FHA domain of pKI-67) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Nori Bovine CD38 ELISA Kit
GR112309 96 Well

Nori Bovine CD38 ELISA Kit

Sign In for Pricing
View Details
Olr1565 Protein Vector (Rat) (pPM-C-HA)
34042026 500 ng

Olr1565 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details