Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF599 Rabbit Polyclonal Antibody (FITC)

ZNF599 Rabbit Polyclonal Antibody (FITC)

Product Specifications

UniProt

Q96NL3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF599

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: MAAPALALVSFEDVVVTFTGEEWGHLDLAQRTLYQEVMLETCRLLVSLGH

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

67kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human

Tested Applications

WB

NCBI Accession Number

NP_001007249

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Influenza A (Nucleoprotein) (MaxLight 650) discontinued
I7650-84-ML650 100 µL

Influenza A (Nucleoprotein) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Human anti-human CCP IgG (54)
A11C09-54 1 Each

Human anti-human CCP IgG (54)

Sign In for Pricing
View Details
PIP4K2A (Phosphatidylinositol-5-phosphate 4-kinase Type-2 alpha, 1-phosphatidylinositol-5-phosphate 4-kinase 2-alpha, Diphosphoinositide Kinase 2-alpha, PIP5KIII, Phosphatidylinositol-5-phosphate 4-kinase Type II alpha, PI (5) P 4-kinase Type II alpha, PIP4KII-alpha, PtdIns (4) P-5-kinase B Isoform, PtdIns (4) P-5-kinase C Isoform, PtdIns (5) P-4-kinase Isoform 2-alpha, PIP5K2, PIP5K2A) (HRP)
131357-HRP 100 µL

PIP4K2A (Phosphatidylinositol-5-phosphate 4-kinase Type-2 alpha, 1-phosphatidylinositol-5-phosphate 4-kinase 2-alpha, Diphosphoinositide Kinase 2-alpha, PIP5KIII, Phosphatidylinositol-5-phosphate 4-kinase Type II alpha, PI (5) P 4-kinase Type II alpha, PIP4KII-alpha, PtdIns (4) P-5-kinase B Isoform, PtdIns (4) P-5-kinase C Isoform, PtdIns (5) P-4-kinase Isoform 2-alpha, PIP5K2, PIP5K2A) (HRP)

Sign In for Pricing
View Details
3-Hydroxy-5- (methoxycarbonyl) phenylboronic Acid Pinacol Ester
425986-01 25 mg

3-Hydroxy-5- (methoxycarbonyl) phenylboronic Acid Pinacol Ester

Sign In for Pricing
View Details
3-Hydroxy-5- (methoxycarbonyl) phenylboronic Acid Pinacol Ester
425986-02 50 mg

3-Hydroxy-5- (methoxycarbonyl) phenylboronic Acid Pinacol Ester

Sign In for Pricing
View Details
Recombinant Anti-CD8 beta Antibody, Rabbit Monoclonal
MBS8104651-01 0.1 mL

Recombinant Anti-CD8 beta Antibody, Rabbit Monoclonal

Sign In for Pricing
View Details