Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PHF19 Rabbit Polyclonal Antibody (HRP)

PHF19 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

PCL3, MTF2L1, TDRD19B

UniProt

Q5T6S3

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human PHF19

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: RRCIFALAVRVSLPSSPVPASPASSSGADQRLPSQSLSSKQKGHTWALET

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

22kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

NP_001009936

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASF1A (Histone Chaperone ASF1A, Anti-silencing Function Protein 1 Homolog A, hAsf1, hAsf1a, CCG1-Interacting Factor A, CIA, hCIA, ASF1A, CGI-98, HSPC146)
318869-01 50 µL

ASF1A (Histone Chaperone ASF1A, Anti-silencing Function Protein 1 Homolog A, hAsf1, hAsf1a, CCG1-Interacting Factor A, CIA, hCIA, ASF1A, CGI-98, HSPC146)

Sign In for Pricing
View Details
ASF1A (Histone Chaperone ASF1A, Anti-silencing Function Protein 1 Homolog A, hAsf1, hAsf1a, CCG1-Interacting Factor A, CIA, hCIA, ASF1A, CGI-98, HSPC146)
318869-02 100 µL

ASF1A (Histone Chaperone ASF1A, Anti-silencing Function Protein 1 Homolog A, hAsf1, hAsf1a, CCG1-Interacting Factor A, CIA, hCIA, ASF1A, CGI-98, HSPC146)

Sign In for Pricing
View Details
PE/Cy7 Anti-dog/ chicken/ rabbit/ guinea pig/ horse/ cow/ mouse/ rat/ pig/ non-human primates/ human CD79a Antibody *HM47*
107901O0-AAT 25 Tests

PE/Cy7 Anti-dog/ chicken/ rabbit/ guinea pig/ horse/ cow/ mouse/ rat/ pig/ non-human primates/ human CD79a Antibody *HM47*

Sign In for Pricing
View Details
Vibrio cholerae O1/O139 Combo
501070 20 Tests/Box

Vibrio cholerae O1/O139 Combo

Sign In for Pricing
View Details
ECSCR, CT (ECSCR, ECSM2, Endothelial cell-specific chemotaxis regulator, Endothelial cell-specific molecule 2) (MaxLight 405)
MBS6294274-01 0.1 mL

ECSCR, CT (ECSCR, ECSM2, Endothelial cell-specific chemotaxis regulator, Endothelial cell-specific molecule 2) (MaxLight 405)

Sign In for Pricing
View Details
ECSCR, CT (ECSCR, ECSM2, Endothelial cell-specific chemotaxis regulator, Endothelial cell-specific molecule 2) (MaxLight 405)
MBS6294274-02 5x 0.1 mL

ECSCR, CT (ECSCR, ECSM2, Endothelial cell-specific chemotaxis regulator, Endothelial cell-specific molecule 2) (MaxLight 405)

Sign In for Pricing
View Details