Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZIK1 Rabbit Polyclonal Antibody (HRP)

ZIK1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZNF762

UniProt

Q3SY52

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZIK1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: LYLEVMLENFALVASLGCGHGTEDEETPSDQNVSVGVSQSKAGSSTQKTQ

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

55kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Human, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_001010879

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prostatic Binding Protein, ID (PBP, Hippocampal Cholinergic Neurostimulating Peptide, HCNP, HCNPpp, Neuropolypeptide h3, Phosphatidylethanolamine Binding Protein, PEBP, Phosphatidylethanolamine Binding Protein 1, PEBP1, PEBP-1, Raf Kinase Inhibitory Protein, RKIP) (Azide free) (HRP) discontinued
P9054-78H-HRP 200 µL

Prostatic Binding Protein, ID (PBP, Hippocampal Cholinergic Neurostimulating Peptide, HCNP, HCNPpp, Neuropolypeptide h3, Phosphatidylethanolamine Binding Protein, PEBP, Phosphatidylethanolamine Binding Protein 1, PEBP1, PEBP-1, Raf Kinase Inhibitory Protein, RKIP) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
Anti-MyD88 Antibody Picoband® (iFluor647 Conjugate)
PB9148-iFluor647 100 µg

Anti-MyD88 Antibody Picoband® (iFluor647 Conjugate)

Sign In for Pricing
View Details
Guinea Pig Cystatin like 1 (CSTL1) ELISA kit
GTR10410767 96 Well

Guinea Pig Cystatin like 1 (CSTL1) ELISA kit

Sign In for Pricing
View Details
Ggt7 ORF Vector (Mouse) (pORF)
ORF045468 1.0 µg DNA

Ggt7 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Hexdc ORF Vector (Mouse) (pORF)
ORF047121 1.0 µg DNA

Hexdc ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
pCMV-Itga5-3×HA-Neo Plasmid
PVT62739 2 µg

pCMV-Itga5-3×HA-Neo Plasmid

Sign In for Pricing
View Details