Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HES5 Rabbit Polyclonal Antibody (Biotin)

HES5 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

BHLHb38

UniProt

Q5TA89

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human HES5

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: AASDTQMKLLYHFQRPPAAPAAPAKEPKAPGAAPPPALSAKATAAAAAAH

Field of Research

Neuroscience

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

18kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_001010926

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Flamma® 648 PEG4-Alkyne
PWG1215_1 mg 1 mg

Flamma® 648 PEG4-Alkyne

Sign In for Pricing
View Details
TSC2 (S1254) (Tuberin, Tuberous Sclerosis 2 Protein, TSC4) (Biotin) discontinued
T9100-25J2-Biotin 200 µL

TSC2 (S1254) (Tuberin, Tuberous Sclerosis 2 Protein, TSC4) (Biotin) discontinued

Sign In for Pricing
View Details
Lentiviral mouse Eif4a1 shRNA (UAS) - Lentiviral mouse Eif4a1 shRNA (UAS, RFP) (25)
GTR15273155 1 Vial

Lentiviral mouse Eif4a1 shRNA (UAS) - Lentiviral mouse Eif4a1 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
ARI8 Antibody
orb784741 2 mg

ARI8 Antibody

Sign In for Pricing
View Details
WBSCR17, CT (WBSCR17, GALNTL3, Putative polypeptide N-acetylgalactosaminyltransferase-like protein 3, Polypeptide GalNAc transferase-like protein 3, Protein-UDP acetylgalactosaminyltransferase-like protein 3, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase-like protein 3, Williams-Beuren syndrome chromosomal region 17 protein) (AP) discontinued
043810-AP 200 µL

WBSCR17, CT (WBSCR17, GALNTL3, Putative polypeptide N-acetylgalactosaminyltransferase-like protein 3, Polypeptide GalNAc transferase-like protein 3, Protein-UDP acetylgalactosaminyltransferase-like protein 3, UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase-like protein 3, Williams-Beuren syndrome chromosomal region 17 protein) (AP) discontinued

Sign In for Pricing
View Details
Lentiviral mouse Sprr2k shRNA (UAS) - Lentiviral mouse Sprr2k shRNA (UAS, GFP) plasmid
GTR15236590 1 Vial

Lentiviral mouse Sprr2k shRNA (UAS) - Lentiviral mouse Sprr2k shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details