Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HELT Rabbit Polyclonal Antibody (HRP)

HELT Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Mgn, HESL, HCM1228, bHLHb44

UniProt

A6NFD8

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human HELT

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EMTVQYLRALHSADFPRGREKAELLAEFANYFHYGYHECMKNLVHYLTTV

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

36kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001025058

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sestrin-1 (SESN1) Mouse ELISA Kit
H0083 96 Tests

Sestrin-1 (SESN1) Mouse ELISA Kit

Sign In for Pricing
View Details
T (T, Brachyury Homolog (mouse), MGC104817, TFT) (APC)
252329-APC 100 µL

T (T, Brachyury Homolog (mouse), MGC104817, TFT) (APC)

Sign In for Pricing
View Details
Androgen receptor Recombinant Antibody, RBITC Conjugated
bsm-61204R-RBITC-TR 20 µL

Androgen receptor Recombinant Antibody, RBITC Conjugated

Sign In for Pricing
View Details
Rabbit Monoclonal CTLA-4 Antibody (CTLA4/6868R) [DyLight 755]
NBP3-20735IR 0.1 mL

Rabbit Monoclonal CTLA-4 Antibody (CTLA4/6868R) [DyLight 755]

Sign In for Pricing
View Details
Eif3g Rat siRNA Oligo Duplex (Locus ID 298700)
SR502929 1 Kit

Eif3g Rat siRNA Oligo Duplex (Locus ID 298700)

Sign In for Pricing
View Details
Anti Myc tag Pab Chicken
161007 100 µg

Anti Myc tag Pab Chicken

Sign In for Pricing
View Details