Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF226 Rabbit Polyclonal Antibody (HRP)

ZNF226 Rabbit Polyclonal Antibody (HRP)

Product Specifications

UniProt

Q9NYT6

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF226

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ACGKSFSRNSHLQSHQRVHTGEKPYKCEECGKGFICSSNLYIHQRVHTGE

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

92kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001027544

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PINX1 Blocking Peptide
33R-2507 0.1 mg

PINX1 Blocking Peptide

Sign In for Pricing
View Details
Polyclonal Antibody to Protease, Serine 1 (PRSS1)
TRV-0036962-01 20 µL

Polyclonal Antibody to Protease, Serine 1 (PRSS1)

Sign In for Pricing
View Details
Polyclonal Antibody to Protease, Serine 1 (PRSS1)
TRV-0036962-02 100 µL

Polyclonal Antibody to Protease, Serine 1 (PRSS1)

Sign In for Pricing
View Details
Polyclonal Antibody to Protease, Serine 1 (PRSS1)
TRV-0036962-03 200 µL

Polyclonal Antibody to Protease, Serine 1 (PRSS1)

Sign In for Pricing
View Details
Polyclonal Antibody to Protease, Serine 1 (PRSS1)
TRV-0036962-04 1 mL

Polyclonal Antibody to Protease, Serine 1 (PRSS1)

Sign In for Pricing
View Details
Lentiviral human TIMM17B shRNA (UAS) - Lentiviral human TIMM17B shRNA (UAS) plasmid
GTR15309214 1 Vial

Lentiviral human TIMM17B shRNA (UAS) - Lentiviral human TIMM17B shRNA (UAS) plasmid

Sign In for Pricing
View Details