Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF284 Rabbit Polyclonal Antibody (HRP)

ZNF284 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZNF284L

UniProt

Q2VY69

Immunogen

The immunogen is a synthetic peptide directed towards the C-terminal region of Human ZN284

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: DCGKSSEHSSCLQDQQSDHSGEKTSKCEDCGKRYERRLNLDMILSLFLND

Purification

Affinity purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Human

Tested Applications

WB

NCBI Accession Number

XP_006723250

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GLMN (glomulin, FKBP Associated Protein, FAP, FAP48, FAP68, FKBPAP, GLML, GVM, VMGLOM) (PE)
MBS6186276-01 0.1 mL

GLMN (glomulin, FKBP Associated Protein, FAP, FAP48, FAP68, FKBPAP, GLML, GVM, VMGLOM) (PE)

Sign In for Pricing
View Details
GLMN (glomulin, FKBP Associated Protein, FAP, FAP48, FAP68, FKBPAP, GLML, GVM, VMGLOM) (PE)
MBS6186276-02 5x 0.1 mL

GLMN (glomulin, FKBP Associated Protein, FAP, FAP48, FAP68, FKBPAP, GLML, GVM, VMGLOM) (PE)

Sign In for Pricing
View Details
Rat Primary Uterine Fibroblasts Cells
AFG-ELL-1189 > 5x 10^5 Cells / Vial

Rat Primary Uterine Fibroblasts Cells

Sign In for Pricing
View Details
Cst6 Rabbit Polyclonal Antibody (Biotin)
orb2107618 100 µL

Cst6 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
C13orf1 (SPRYD7) (NM_001127482) Human Tagged ORF Clone
RG225140 10 µg

C13orf1 (SPRYD7) (NM_001127482) Human Tagged ORF Clone

Sign In for Pricing
View Details
ZBTB25, CT (ZBTB25, C14orf51, KUP, ZNF46, Zinc finger and BTB domain-containing protein 25, Zinc finger protein 46, Zinc finger protein KUP) (FITC) discontinued
043995-FITC 200 µL

ZBTB25, CT (ZBTB25, C14orf51, KUP, ZNF46, Zinc finger and BTB domain-containing protein 25, Zinc finger protein 46, Zinc finger protein KUP) (FITC) discontinued

Sign In for Pricing
View Details