Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FLJ44894 Rabbit Polyclonal Antibody (Biotin)

FLJ44894 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ZNF826

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human FLJ44894

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: HRRTHTGEKPYKCEECGKAFTASSTLSEYKTIHTGEKPCKCEECGKAFNW

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse, Porcine

Tested Applications

WB

NCBI Accession Number

NP_001034973

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Psmd3 Mouse Gene Knockout Kit (CRISPR)
KN514122 1 Kit

Psmd3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
L-Argininic Acid-13C6
TRC-A769197-5MG 5 mg

L-Argininic Acid-13C6

Sign In for Pricing
View Details
Cytochrome P450 Reductase (POR) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4G2]
TA500591AM 100 µL

Cytochrome P450 Reductase (POR) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4G2]

Sign In for Pricing
View Details
ERG (NM_004449) Human Recombinant Protein
TP318892M 100 µg

ERG (NM_004449) Human Recombinant Protein

Sign In for Pricing
View Details
Cnbp (NM_013493) Mouse Tagged ORF Clone
MG201568 10 µg

Cnbp (NM_013493) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
PPM1F Mouse Monoclonal Antibody [Clone ID: AT6D11]
AM50063PU-S 50 µL

PPM1F Mouse Monoclonal Antibody [Clone ID: AT6D11]

Sign In for Pricing
View Details