Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FLJ44894 Rabbit Polyclonal Antibody (HRP)

FLJ44894 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

ZNF826

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human FLJ44894

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HRRTHTGEKPYKCEECGKAFTASSTLSEYKTIHTGEKPCKCEECGKAFNW

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

21kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Human, Mouse, Porcine

Tested Applications

WB

NCBI Accession Number

NP_001034973

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZDHHC23 Protein Vector (Rat) (pPM-C-HA)
PV317400 500 ng

ZDHHC23 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
POLR2A (Phospho-Ser5) Rabbit mAb
14249 50 µL

POLR2A (Phospho-Ser5) Rabbit mAb

Sign In for Pricing
View Details
Recombinant Human KPNA6 Protein - (Dry Ice)
H00023633-P01-10ug 10 µg

Recombinant Human KPNA6 Protein - (Dry Ice)

Sign In for Pricing
View Details
Rabbit anti-Calsarcin 1 Antibody
YLD1096-01 50 µL

Rabbit anti-Calsarcin 1 Antibody

Sign In for Pricing
View Details
Rabbit anti-Calsarcin 1 Antibody
YLD1096-02 100 µL

Rabbit anti-Calsarcin 1 Antibody

Sign In for Pricing
View Details
PQBP4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV741559 1.0 µg DNA

PQBP4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details