Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZXDC Rabbit Polyclonal Antibody (FITC)

ZXDC Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ZXDL

UniProt

Q2QGD7

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZXDC

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NLKAHMKGHEQESLFKCEVCAERFPTHAKLSSHQRSHFEPERPYKCDFPG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

75kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_001035743

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fluorescent Liposomes - 20 mL
I-020 20 mL

Fluorescent Liposomes - 20 mL

Sign In for Pricing
View Details
TNFRSF11A (Tumor Necrosis Factor Receptor Superfamily Member 11A, Osteoclast Differentiation Factor Receptor, CD265, FEO, LOH18CR1, ODFR, OFE, OPTB7, OSTS, PDB2, RANK, TRANCER)
368369 100 µg

TNFRSF11A (Tumor Necrosis Factor Receptor Superfamily Member 11A, Osteoclast Differentiation Factor Receptor, CD265, FEO, LOH18CR1, ODFR, OFE, OPTB7, OSTS, PDB2, RANK, TRANCER)

Sign In for Pricing
View Details
CCDC25 Protein Vector (Human) (pPM-C-His)
PV007892 500 ng

CCDC25 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Human AGMO qPCR Primer Pair
QH76525S 200 Tests

Human AGMO qPCR Primer Pair

Sign In for Pricing
View Details
Acp2 (NM_007387) Mouse Tagged ORF Clone Lentiviral Particle
MR206733L4V 200 µL

Acp2 (NM_007387) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse Olfactory receptor 5A2 (OR5A2) ELISA Kit
GTR10313943 96 Well

Mouse Olfactory receptor 5A2 (OR5A2) ELISA Kit

Sign In for Pricing
View Details