Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zfp113 Rabbit Polyclonal Antibody (Biotin)

Zfp113 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

MKIAA4229, 4732456B05Rik

UniProt

Q8C689

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: PHKCDECSKSFNRTSDLIQHQRIHTGEKPYECSECGKAFSQSAHLIQHQR

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

50kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Goat, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_062721

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD28 (C28/76), CF647 conjugate, 0.1mg/mL
BNC470076-100 1x 100 µL

CD28 (C28/76), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GPR137C (TM7SF1L2, Integral Membrane Protein GPR137C, Transmembrane 7 Superfamily Member 1-like 2 Protein)
317769-01 50 µg

GPR137C (TM7SF1L2, Integral Membrane Protein GPR137C, Transmembrane 7 Superfamily Member 1-like 2 Protein)

Sign In for Pricing
View Details
GPR137C (TM7SF1L2, Integral Membrane Protein GPR137C, Transmembrane 7 Superfamily Member 1-like 2 Protein)
317769-02 100 µg

GPR137C (TM7SF1L2, Integral Membrane Protein GPR137C, Transmembrane 7 Superfamily Member 1-like 2 Protein)

Sign In for Pricing
View Details
Prostaglandin E Synthase 2 (PTGES2) Polyclonal Antibody
CAU26844-01 100 µL

Prostaglandin E Synthase 2 (PTGES2) Polyclonal Antibody

Sign In for Pricing
View Details
Prostaglandin E Synthase 2 (PTGES2) Polyclonal Antibody
CAU26844-02 200 µL

Prostaglandin E Synthase 2 (PTGES2) Polyclonal Antibody

Sign In for Pricing
View Details
Prostaglandin E Synthase 2 (PTGES2) Polyclonal Antibody
CAU26844-03 1 mL

Prostaglandin E Synthase 2 (PTGES2) Polyclonal Antibody

Sign In for Pricing
View Details