Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF3H Rabbit Polyclonal Antibody (FITC)

EIF3H Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

EIF3S3, eIF3-p40, eIF3-gamma

UniProt

O15372

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human EIF3H

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LMDRVDEMSQDIVKYNTYMRNTSKQQQQKHQYQQRRQQENMQRQSRGEPP

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

40kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_003747

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Mouse CD45R/B220 Monoclonal Antibody (PerCP Conjugated)
MBS2556918-01 50 Tests

Anti-Mouse CD45R/B220 Monoclonal Antibody (PerCP Conjugated)

Sign In for Pricing
View Details
Anti-Mouse CD45R/B220 Monoclonal Antibody (PerCP Conjugated)
MBS2556918-02 100 Tests

Anti-Mouse CD45R/B220 Monoclonal Antibody (PerCP Conjugated)

Sign In for Pricing
View Details
Anti-Mouse CD45R/B220 Monoclonal Antibody (PerCP Conjugated)
MBS2556918-03 2x 100 Tests

Anti-Mouse CD45R/B220 Monoclonal Antibody (PerCP Conjugated)

Sign In for Pricing
View Details
Anti-Mouse CD45R/B220 Monoclonal Antibody (PerCP Conjugated)
MBS2556918-04 10x 100 Tests

Anti-Mouse CD45R/B220 Monoclonal Antibody (PerCP Conjugated)

Sign In for Pricing
View Details
DHTKD1, ID (DHTKD1, KIAA1630, Probable 2-oxoglutarate dehydrogenase E1 component DHKTD1, mitochondrial, Dehydrogenase E1 and transketolase domain-containing protein 1) (MaxLight 490) discontinued
034629-ML490 100 µL

DHTKD1, ID (DHTKD1, KIAA1630, Probable 2-oxoglutarate dehydrogenase E1 component DHKTD1, mitochondrial, Dehydrogenase E1 and transketolase domain-containing protein 1) (MaxLight 490) discontinued

Sign In for Pricing
View Details
Human SMCP Pre-designed siRNA Set B
SI015304B 1 Each

Human SMCP Pre-designed siRNA Set B

Sign In for Pricing
View Details