Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ING1 Rabbit Polyclonal Antibody (HRP)

ING1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

P33, p47, p33ING1, p24ING1c, p33ING1b, p47ING1a

UniProt

Q5T9H0

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ING1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: EKKAKTSKKKKRSKAKAEREASPADLPIDPNEPTYCLCNQVSYGEMIGCD

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

32kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_937862

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal Adenosylhomocysteinase/AHCY Antibody (4E9H10)
NBP3-16147-20ul 20 µL

Rabbit Monoclonal Adenosylhomocysteinase/AHCY Antibody (4E9H10)

Sign In for Pricing
View Details
Olr1372 sgRNA CRISPR Lentivector set (Rat)
K7422101 3x 1.0 µg

Olr1372 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
C9orf71 Polyclonal Antibody, Biotin Conjugated
bs-15340R-Biotin 100 µL

C9orf71 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
ARHGDIA (Rho GDP-dissociation Inhibitor 1, Rho GDI 1, Rho-GDI alpha, GDIA1) (PE)
123494-PE 100 µL

ARHGDIA (Rho GDP-dissociation Inhibitor 1, Rho GDI 1, Rho-GDI alpha, GDIA1) (PE)

Sign In for Pricing
View Details
ERCC1 Antibody, Biotin conjugated
A20815-50UG 50 µg

ERCC1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
TCTP (TPT1) (NM_003295) Human Mass Spec Standard
PH301664 10 µg

TCTP (TPT1) (NM_003295) Human Mass Spec Standard

Sign In for Pricing
View Details