Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C1D Rabbit Polyclonal Antibody (FITC)

C1D Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

LRP1, hC1D, Rrp47, SUNCOR, SUN-CoR

UniProt

Q13901

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human C1D

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: LDPLEQAKVDLVSAYTLNSMFWVYLATQGVNPKEHPVKQELERIRVYMNR

Field of Research

Cell Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

16kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_006324

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRTN3 Antibody - N-terminal region : FITC (ARP61166_P050-FITC)
ARP61166_P050-FITC 100 µL

PRTN3 Antibody - N-terminal region : FITC (ARP61166_P050-FITC)

Sign In for Pricing
View Details
β ig-h3 siRNA (m)
sc-43124 10 µM

β ig-h3 siRNA (m)

Sign In for Pricing
View Details
Rabbit Anti-Human HDAC4 pAb
PA6196-01 50 μL

Rabbit Anti-Human HDAC4 pAb

Sign In for Pricing
View Details
Rabbit Anti-Human HDAC4 pAb
PA6196-02 100 μL

Rabbit Anti-Human HDAC4 pAb

Sign In for Pricing
View Details
CA IX (Carbonic Anhydrase 9, Carbonate dehydratase IX, Carbonic Anhydrase IX, CA-IX, CAIX, Membrane Antigen MN, P54/58N, Renal Cell Carcinoma-Associated Antigen G250, RCC-Associated Antigen G250 pMW1, CA9, G250, MN) discontinued
221232-01 50 µL

CA IX (Carbonic Anhydrase 9, Carbonate dehydratase IX, Carbonic Anhydrase IX, CA-IX, CAIX, Membrane Antigen MN, P54/58N, Renal Cell Carcinoma-Associated Antigen G250, RCC-Associated Antigen G250 pMW1, CA9, G250, MN) discontinued

Sign In for Pricing
View Details
CA IX (Carbonic Anhydrase 9, Carbonate dehydratase IX, Carbonic Anhydrase IX, CA-IX, CAIX, Membrane Antigen MN, P54/58N, Renal Cell Carcinoma-Associated Antigen G250, RCC-Associated Antigen G250 pMW1, CA9, G250, MN) discontinued
221232-02 100 µL

CA IX (Carbonic Anhydrase 9, Carbonate dehydratase IX, Carbonic Anhydrase IX, CA-IX, CAIX, Membrane Antigen MN, P54/58N, Renal Cell Carcinoma-Associated Antigen G250, RCC-Associated Antigen G250 pMW1, CA9, G250, MN) discontinued

Sign In for Pricing
View Details