Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF182 Rabbit Polyclonal Antibody (Biotin)

ZNF182 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

KOX14, ZNF21, HHZ150, Zfp182

UniProt

P17025

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ZNF182

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: CGKAFREKSTFTVHQRTHTGEKPYKCTECGKAFTQKSNLIVHQRTHAGKK

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

74kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_008893

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GTPBP9 (OLA1) (NM_013341) Human Tagged Lenti ORF Clone
RC220834L4 10 µg

GTPBP9 (OLA1) (NM_013341) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mouse IgG2b, kappa Isotype Control (APC/Cyanine5.5 Conjugated)
MBS4516503-01 0.025 mg

Mouse IgG2b, kappa Isotype Control (APC/Cyanine5.5 Conjugated)

Sign In for Pricing
View Details
Mouse IgG2b, kappa Isotype Control (APC/Cyanine5.5 Conjugated)
MBS4516503-02 0.05 mg

Mouse IgG2b, kappa Isotype Control (APC/Cyanine5.5 Conjugated)

Sign In for Pricing
View Details
Mouse IgG2b, kappa Isotype Control (APC/Cyanine5.5 Conjugated)
MBS4516503-03 0.1 mg

Mouse IgG2b, kappa Isotype Control (APC/Cyanine5.5 Conjugated)

Sign In for Pricing
View Details
Mouse IgG2b, kappa Isotype Control (APC/Cyanine5.5 Conjugated)
MBS4516503-04 5x 0.1 mg

Mouse IgG2b, kappa Isotype Control (APC/Cyanine5.5 Conjugated)

Sign In for Pricing
View Details
Rabbit anti-CCDC47 Antibody, Affinity Purified
A305-101A-T 10 µg

Rabbit anti-CCDC47 Antibody, Affinity Purified

Sign In for Pricing
View Details