Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRTFB Rabbit Polyclonal Antibody (Biotin)

MRTFB Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Mkl2, RGD1560833

UniProt

D4A686

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Rat RGD1560833

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: ERKNVLQLKLQQRRTREQLVDQGIMPPLKSPAAFHEQIKSLERARTENFL

Field of Research

Stem Cell & Developmental Biology

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

13kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

XP_002727741

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PGLYRP1 Antibody
CSB-PA406529-01 50 µg

PGLYRP1 Antibody

Sign In for Pricing
View Details
PGLYRP1 Antibody
CSB-PA406529-02 100 µg

PGLYRP1 Antibody

Sign In for Pricing
View Details
Goat Toll Like Receptor 8 ELISA Kit
MBS753795-01 48 Well

Goat Toll Like Receptor 8 ELISA Kit

Sign In for Pricing
View Details
Goat Toll Like Receptor 8 ELISA Kit
MBS753795-02 96 Well

Goat Toll Like Receptor 8 ELISA Kit

Sign In for Pricing
View Details
Goat Toll Like Receptor 8 ELISA Kit
MBS753795-03 5x 96 Well

Goat Toll Like Receptor 8 ELISA Kit

Sign In for Pricing
View Details
Goat Toll Like Receptor 8 ELISA Kit
MBS753795-04 10x 96 Well

Goat Toll Like Receptor 8 ELISA Kit

Sign In for Pricing
View Details