Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PYGO1 Rabbit Polyclonal Antibody (FITC)

PYGO1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

DKFZp547G0910

UniProt

Q9Y3Y4

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PYGO1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: GGPGVQLGSPDKKKRKANTQGPSFPPLSEYAPPPNPNSDHLVAANPFDDN

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_056432

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea pig Anti-Histone Antibody (AHA) ELISA Kit
MBS267743-01 48 Well

Guinea pig Anti-Histone Antibody (AHA) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Anti-Histone Antibody (AHA) ELISA Kit
MBS267743-02 96 Well

Guinea pig Anti-Histone Antibody (AHA) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Anti-Histone Antibody (AHA) ELISA Kit
MBS267743-03 5x 96 Well

Guinea pig Anti-Histone Antibody (AHA) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Anti-Histone Antibody (AHA) ELISA Kit
MBS267743-04 10x 96 Well

Guinea pig Anti-Histone Antibody (AHA) ELISA Kit

Sign In for Pricing
View Details
RBP4 Antibody / Retinol Binding Protein 4
V8710-20UG 20 µg

RBP4 Antibody / Retinol Binding Protein 4

Sign In for Pricing
View Details
ELK3 (ETS Domain-containing Protein Elk-3, ETS-related Protein ERP, ETS-related Protein NET, Serum Response Factor Accessory Protein 2, SAP-2, SRF Accessory Protein 2, NET, SAP2) (MaxLight 405) discontinued
126283-ML405 100 µL

ELK3 (ETS Domain-containing Protein Elk-3, ETS-related Protein ERP, ETS-related Protein NET, Serum Response Factor Accessory Protein 2, SAP-2, SRF Accessory Protein 2, NET, SAP2) (MaxLight 405) discontinued

Sign In for Pricing
View Details