Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTOV1 Rabbit Polyclonal Antibody (FITC)

PTOV1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

ACID2, PTOV-1

UniProt

Q86YD1

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PTOV1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: DSTAKLKRTLPCQAYVNQGENLETDQWPQKLIMQLIPQQLLTTLGPLFRN

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

47kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Human, Mouse, Porcine, Rat

Tested Applications

IHC, WB

NCBI Accession Number

NP_059128

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD35 (C3 binding Protein, C3b/C4b receptor, C3BR, C4BR, Complement Component (3b/4b) receptor 1 including Knops blood group system, Complement receptor type 1, KN, Knops blood group antigen, CR1) (BSA & Azide Free) (MaxLight 550)
172047-AF-ML550 100 µL

CD35 (C3 binding Protein, C3b/C4b receptor, C3BR, C4BR, Complement Component (3b/4b) receptor 1 including Knops blood group system, Complement receptor type 1, KN, Knops blood group antigen, CR1) (BSA & Azide Free) (MaxLight 550)

Sign In for Pricing
View Details
APC_Cy7 Linked Polyclonal Antibody to Platelet Factor 4 (PF4)
MBS2128758-01 0.1 mL

APC_Cy7 Linked Polyclonal Antibody to Platelet Factor 4 (PF4)

Sign In for Pricing
View Details
APC_Cy7 Linked Polyclonal Antibody to Platelet Factor 4 (PF4)
MBS2128758-02 0.2 mL

APC_Cy7 Linked Polyclonal Antibody to Platelet Factor 4 (PF4)

Sign In for Pricing
View Details
APC_Cy7 Linked Polyclonal Antibody to Platelet Factor 4 (PF4)
MBS2128758-03 0.5 mL

APC_Cy7 Linked Polyclonal Antibody to Platelet Factor 4 (PF4)

Sign In for Pricing
View Details
APC_Cy7 Linked Polyclonal Antibody to Platelet Factor 4 (PF4)
MBS2128758-04 1 mL

APC_Cy7 Linked Polyclonal Antibody to Platelet Factor 4 (PF4)

Sign In for Pricing
View Details
APC_Cy7 Linked Polyclonal Antibody to Platelet Factor 4 (PF4)
MBS2128758-05 5 mL

APC_Cy7 Linked Polyclonal Antibody to Platelet Factor 4 (PF4)

Sign In for Pricing
View Details