Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MBTD1 Rabbit Polyclonal Antibody (HRP)

MBTD1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

SA49P01

UniProt

Q05BQ5

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human MBTD1

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: PFKPCMRVEVVDKRHLCRTRVAVVESVIGGRLRLVYEESEDRTDDFWCHM

Field of Research

Epigenetics & Chromatin

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

45kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Immunoglobulin Heavy Constant Gamma 3 (IGHG3) ELISA Development Kit
abx378477-01 5x 96 Tests

Human Immunoglobulin Heavy Constant Gamma 3 (IGHG3) ELISA Development Kit

Sign In for Pricing
View Details
Human Immunoglobulin Heavy Constant Gamma 3 (IGHG3) ELISA Development Kit
abx378477-02 15x 96 Tests

Human Immunoglobulin Heavy Constant Gamma 3 (IGHG3) ELISA Development Kit

Sign In for Pricing
View Details
Fibroblast Growth Factor, Acidic (FGFa) (Biotin)
MBS625870-01 0.025 mg

Fibroblast Growth Factor, Acidic (FGFa) (Biotin)

Sign In for Pricing
View Details
Fibroblast Growth Factor, Acidic (FGFa) (Biotin)
MBS625870-02 0.05 mg

Fibroblast Growth Factor, Acidic (FGFa) (Biotin)

Sign In for Pricing
View Details
Fibroblast Growth Factor, Acidic (FGFa) (Biotin)
MBS625870-03 5x 0.05 mg

Fibroblast Growth Factor, Acidic (FGFa) (Biotin)

Sign In for Pricing
View Details
Nori® Human NADPH Oxydase 2 (NOX2) ELISA Kit
GR111143 96 Well

Nori® Human NADPH Oxydase 2 (NOX2) ELISA Kit

Sign In for Pricing
View Details