Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lrrfip1 Rabbit Polyclonal Antibody (Biotin)

Lrrfip1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Fl, Fliiap1, AU024550

UniProt

Q3UZ39

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: NGTDAHVMDLQRDANRQISDLKFKLAKSEQEITALEQNVIRLESQVTRYR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

71kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_032541

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD247 (T-cell Surface Glycoprotein CD3 zeta Chain, T-cell Receptor T3 zeta Chain, CD3Z, T3Z, TCRZ) (PE)
124588-PE 100 µL

CD247 (T-cell Surface Glycoprotein CD3 zeta Chain, T-cell Receptor T3 zeta Chain, CD3Z, T3Z, TCRZ) (PE)

Sign In for Pricing
View Details
ADAM7 Antibody, FITC conjugated
A67058-100UG 100 µg

ADAM7 Antibody, FITC conjugated

Sign In for Pricing
View Details
Lentiviral human CD3G shRNA (UAS) - Lentiviral human CD3G shRNA (UAS, iRFP) (25)
GTR15329477 1 Vial

Lentiviral human CD3G shRNA (UAS) - Lentiviral human CD3G shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
Carbonic anhydrase X (CA10) (NM_001082534) Human Tagged ORF Clone Lentiviral Particle
RC212539L4V 200 µL

Carbonic anhydrase X (CA10) (NM_001082534) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Psmd10 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3746106 1.0 µg DNA

Psmd10 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Peroxisome Proliferator Activated Receptor Alpha (PPARa)
MBS2143727-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Peroxisome Proliferator Activated Receptor Alpha (PPARa)

Sign In for Pricing
View Details