Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Lrrfip1 Rabbit Polyclonal Antibody (FITC)

Lrrfip1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

Fl, Fliiap1, AU024550

UniProt

Q3UZ39

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: NGTDAHVMDLQRDANRQISDLKFKLAKSEQEITALEQNVIRLESQVTRYR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

71kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_032541

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-OR8BC OR8B12 Antibody
A16907 100 µL

Anti-OR8BC OR8B12 Antibody

Sign In for Pricing
View Details
ZNF768, NT (ZNF768, Zinc finger protein 768)
044357 200 µL

ZNF768, NT (ZNF768, Zinc finger protein 768)

Sign In for Pricing
View Details
Podoplanin (Glycoprotein 36, GP36, PA2.26 Antigen, T1-alpha, T1A, Aggrus, PDPN, PSEC0003, PSEC0025) (APC)
MBS6260902-01 0.1 mL

Podoplanin (Glycoprotein 36, GP36, PA2.26 Antigen, T1-alpha, T1A, Aggrus, PDPN, PSEC0003, PSEC0025) (APC)

Sign In for Pricing
View Details
Podoplanin (Glycoprotein 36, GP36, PA2.26 Antigen, T1-alpha, T1A, Aggrus, PDPN, PSEC0003, PSEC0025) (APC)
MBS6260902-02 5x 0.1 mL

Podoplanin (Glycoprotein 36, GP36, PA2.26 Antigen, T1-alpha, T1A, Aggrus, PDPN, PSEC0003, PSEC0025) (APC)

Sign In for Pricing
View Details
MG 149
HY-15887-01 1 mg

MG 149

Sign In for Pricing
View Details
MG 149
HY-15887-02 5 mg

MG 149

Sign In for Pricing
View Details