Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yeats2 Rabbit Polyclonal Antibody (FITC)

Yeats2 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

BC042768, mKIAA1197

UniProt

Q3TUF7

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Yeats2

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: FDPMAFNHPAIKKFLESPSRSSSPTNQRSETPSANHSESDSLSQHNDFLS

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_001139403

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DDIT4L (REDD2, RTP801L, DNA Damage-inducible Transcript 4-like Protein, HIF-1 Responsive Protein RTP801-like, Protein Regulated in Development and DNA Damage Response 2) (MaxLight 405)
MBS6189752-01 0.1 mL

DDIT4L (REDD2, RTP801L, DNA Damage-inducible Transcript 4-like Protein, HIF-1 Responsive Protein RTP801-like, Protein Regulated in Development and DNA Damage Response 2) (MaxLight 405)

Sign In for Pricing
View Details
DDIT4L (REDD2, RTP801L, DNA Damage-inducible Transcript 4-like Protein, HIF-1 Responsive Protein RTP801-like, Protein Regulated in Development and DNA Damage Response 2) (MaxLight 405)
MBS6189752-02 5x 0.1 mL

DDIT4L (REDD2, RTP801L, DNA Damage-inducible Transcript 4-like Protein, HIF-1 Responsive Protein RTP801-like, Protein Regulated in Development and DNA Damage Response 2) (MaxLight 405)

Sign In for Pricing
View Details
SOX10 Antibody
V8813-20UG 20 µg

SOX10 Antibody

Sign In for Pricing
View Details
Human Cytokeratin 5/6 ELISA Kit
MBS3803788-01 48 Well

Human Cytokeratin 5/6 ELISA Kit

Sign In for Pricing
View Details
Human Cytokeratin 5/6 ELISA Kit
MBS3803788-02 96 Well

Human Cytokeratin 5/6 ELISA Kit

Sign In for Pricing
View Details
Human Cytokeratin 5/6 ELISA Kit
MBS3803788-03 5x 96 Well

Human Cytokeratin 5/6 ELISA Kit

Sign In for Pricing
View Details