Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ME2 Rabbit Polyclonal Antibody (Biotin)

ME2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

ODS1

UniProt

P23368

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ME2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: MAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMG

Field of Research

Metabolism Research

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

65kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_002387

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZBTB44, CT (ZBTB44, BTBD15, ZNF851, Zinc finger and BTB domain-containing protein 44, BTB/POZ domain-containing protein 15, Zinc finger protein 851) (FITC) discontinued
044003-FITC 200 µL

ZBTB44, CT (ZBTB44, BTBD15, ZNF851, Zinc finger and BTB domain-containing protein 44, BTB/POZ domain-containing protein 15, Zinc finger protein 851) (FITC) discontinued

Sign In for Pricing
View Details
Mouse Monoclonal Bassoon Antibody (SAP7F407) [Alexa Fluor 350]
NB120-13249AF350 0.2 mL

Mouse Monoclonal Bassoon Antibody (SAP7F407) [Alexa Fluor 350]

Sign In for Pricing
View Details
Tgfb3 (NM_013174) Rat Untagged Clone
RN211059 10 µg

Tgfb3 (NM_013174) Rat Untagged Clone

Sign In for Pricing
View Details
Ccdc62 AAV siRNA Pooled Vector
15288166 1.0 µg

Ccdc62 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
CD28, Human/Cynomolgus/Rhesus Macaque (Biotinylated, HEK293, Fc-Avi)
HY-P72353-01 20 µg

CD28, Human/Cynomolgus/Rhesus Macaque (Biotinylated, HEK293, Fc-Avi)

Sign In for Pricing
View Details
CD28, Human/Cynomolgus/Rhesus Macaque (Biotinylated, HEK293, Fc-Avi)
HY-P72353-02 100 µg

CD28, Human/Cynomolgus/Rhesus Macaque (Biotinylated, HEK293, Fc-Avi)

Sign In for Pricing
View Details