Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NRIP3 Rabbit Polyclonal Antibody (HRP)

NRIP3 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

C11orf14, NY-SAR-105

UniProt

Q9NQ35

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human NRIP3

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: ALVDTGCLYNLISLACVDRLGLKEHVKSHKHEGEKLSLPRHLKVVGQIEH

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

27kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat

Tested Applications

WB

NCBI Accession Number

NP_065696

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AdmiRa-rno-miR-99a-3p Virus
mr0974 250 µL

AdmiRa-rno-miR-99a-3p Virus

Sign In for Pricing
View Details
LOC100504406 3'UTR Luciferase Stable Cell Line
TU112044 1.0 mL

LOC100504406 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
ITM2B (Integral Membrane Protein 2B, Protein E25B, Transmembrane Protein BRI, BRI, BRI2) (MaxLight 750)
MBS6383320-01 0.1 mL

ITM2B (Integral Membrane Protein 2B, Protein E25B, Transmembrane Protein BRI, BRI, BRI2) (MaxLight 750)

Sign In for Pricing
View Details
ITM2B (Integral Membrane Protein 2B, Protein E25B, Transmembrane Protein BRI, BRI, BRI2) (MaxLight 750)
MBS6383320-02 5x 0.1 mL

ITM2B (Integral Membrane Protein 2B, Protein E25B, Transmembrane Protein BRI, BRI, BRI2) (MaxLight 750)

Sign In for Pricing
View Details
ELISA Kit for Lipocalin 1 (LCN1)
TRV-0046103-01 24 Tests

ELISA Kit for Lipocalin 1 (LCN1)

Sign In for Pricing
View Details
ELISA Kit for Lipocalin 1 (LCN1)
TRV-0046103-02 48 Tests

ELISA Kit for Lipocalin 1 (LCN1)

Sign In for Pricing
View Details