Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ankra2 Rabbit Polyclonal Antibody (Biotin)

Ankra2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

Ankra, 1110004M18Rik

UniProt

Q99PE2

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Ankra2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VAMGMKFILPNRFDMNVCSRFVKSLNEEDSKNIQDQVNSDLEVASVLFKA

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

34kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Rabbit, Rat, Yeast, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_075961

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Tartrate Resistant Acid Phosphatase (ACP5) activation kit by CRISPRa
GA100042 1 Kit

Human Tartrate Resistant Acid Phosphatase (ACP5) activation kit by CRISPRa

Sign In for Pricing
View Details
Porcine Super Oxidase Dimutase, SOD ELISA Kit
YLA0098PO-01 48 Tests

Porcine Super Oxidase Dimutase, SOD ELISA Kit

Sign In for Pricing
View Details
Porcine Super Oxidase Dimutase, SOD ELISA Kit
YLA0098PO-02 96 Tests

Porcine Super Oxidase Dimutase, SOD ELISA Kit

Sign In for Pricing
View Details
Dmt-2'-f-dc(ac) amidite
MBS5799610 Inquire

Dmt-2'-f-dc(ac) amidite

Sign In for Pricing
View Details
Olfr1385 Mouse shRNA Plasmid (Locus ID 258027)
TL507594 1 Kit

Olfr1385 Mouse shRNA Plasmid (Locus ID 258027)

Sign In for Pricing
View Details
Guinea Pig Ras related protein Rab 33B (RAB33B) ELISA kit
GTR10377123 96 Well

Guinea Pig Ras related protein Rab 33B (RAB33B) ELISA kit

Sign In for Pricing
View Details