Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

OCEL1 Rabbit Polyclonal Antibody (Biotin)

OCEL1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

FWP009, S863-9

UniProt

Q9H607

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human OCEL1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: VWREFEMKRMDPGFLDKQARCHYLKGKLRHLKTQIQKFDDQGDSEGSVYF

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

29kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Porcine, Rat

Tested Applications

WB

NCBI Accession Number

NP_078854

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NXPH4 polyclonal antibody
orb1719241-01 50 µL

NXPH4 polyclonal antibody

Sign In for Pricing
View Details
NXPH4 polyclonal antibody
orb1719241-02 100 µL

NXPH4 polyclonal antibody

Sign In for Pricing
View Details
Hsa-miR-496 miRNA Mimic
CMH0249-01 5 nmol

Hsa-miR-496 miRNA Mimic

Sign In for Pricing
View Details
Hsa-miR-496 miRNA Mimic
CMH0249-02 10 nmol

Hsa-miR-496 miRNA Mimic

Sign In for Pricing
View Details
PABPN1L, ID (PABPN1L, EPABP2, PABPNL1, Embryonic polyadenylate-binding protein 2, Embryonic poly(A)-binding protein type II, Poly(A)-binding protein nuclear-like 1) (MaxLight 650)
MBS6330403-01 0.1 mL

PABPN1L, ID (PABPN1L, EPABP2, PABPNL1, Embryonic polyadenylate-binding protein 2, Embryonic poly(A)-binding protein type II, Poly(A)-binding protein nuclear-like 1) (MaxLight 650)

Sign In for Pricing
View Details
PABPN1L, ID (PABPN1L, EPABP2, PABPNL1, Embryonic polyadenylate-binding protein 2, Embryonic poly(A)-binding protein type II, Poly(A)-binding protein nuclear-like 1) (MaxLight 650)
MBS6330403-02 5x 0.1 mL

PABPN1L, ID (PABPN1L, EPABP2, PABPNL1, Embryonic polyadenylate-binding protein 2, Embryonic poly(A)-binding protein type II, Poly(A)-binding protein nuclear-like 1) (MaxLight 650)

Sign In for Pricing
View Details