Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NRIP2 Rabbit Polyclonal Antibody (Biotin)

NRIP2 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

DKFZP761G1913

UniProt

A2RRE3

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NRIP2

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: HLSQQRRLKQATQFLHKDSADLLPLDSLKRLGTSKDLQPRSVIQRRLVEG

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

31kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_113662

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Six Transmembrane Epithelial Antigen of The Prostate 2 ELISA Kit
MBS061347-01 48 Well

Canine Six Transmembrane Epithelial Antigen of The Prostate 2 ELISA Kit

Sign In for Pricing
View Details
Canine Six Transmembrane Epithelial Antigen of The Prostate 2 ELISA Kit
MBS061347-02 96 Well

Canine Six Transmembrane Epithelial Antigen of The Prostate 2 ELISA Kit

Sign In for Pricing
View Details
Canine Six Transmembrane Epithelial Antigen of The Prostate 2 ELISA Kit
MBS061347-03 5x 96 Well

Canine Six Transmembrane Epithelial Antigen of The Prostate 2 ELISA Kit

Sign In for Pricing
View Details
Canine Six Transmembrane Epithelial Antigen of The Prostate 2 ELISA Kit
MBS061347-04 10x 96 Well

Canine Six Transmembrane Epithelial Antigen of The Prostate 2 ELISA Kit

Sign In for Pricing
View Details
PetG Antibody
orb837685 2 mg

PetG Antibody

Sign In for Pricing
View Details
TOR3A siRNA (Mouse)
orb1844210-01 15 nmol

TOR3A siRNA (Mouse)

Sign In for Pricing
View Details