Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Maf1 Rabbit Polyclonal Antibody (HRP)

Maf1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Maf, AU042856, 1110068E11Rik

UniProt

Q9D0U6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HVLEALSPPQTSGLSPSRLSKSQGGEDESPLSDKCSRKTLFYLIATLNES

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_001158079

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NYTIE-12.5x720-BK Tag Ties
196305 50 Pack (50 Piece (s) x 1 Pack)

NYTIE-12.5x720-BK Tag Ties

Sign In for Pricing
View Details
Lentiviral mouse Vstm2l shRNA (UAS) - Lentiviral mouse Vstm2l shRNA (UAS) plasmid
GTR15279967 1 Vial

Lentiviral mouse Vstm2l shRNA (UAS) - Lentiviral mouse Vstm2l shRNA (UAS) plasmid

Sign In for Pricing
View Details
Chicken Filamin C, Gamma ELISA Kit
MBS033659 Inquire

Chicken Filamin C, Gamma ELISA Kit

Sign In for Pricing
View Details
Canine Thyroid Stimulating Hormone (TSH) ELISA Kit
AE13136DO-01 48 Tests

Canine Thyroid Stimulating Hormone (TSH) ELISA Kit

Sign In for Pricing
View Details
Canine Thyroid Stimulating Hormone (TSH) ELISA Kit
AE13136DO-02 96 Tests

Canine Thyroid Stimulating Hormone (TSH) ELISA Kit

Sign In for Pricing
View Details
Nori® Chicken 4-Plex ELISA Kits-IL1A-IL-6-IL8-TNFA
GR241010 96 Well

Nori® Chicken 4-Plex ELISA Kits-IL1A-IL-6-IL8-TNFA

Sign In for Pricing
View Details