Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Maf1 Rabbit Polyclonal Antibody (HRP)

Maf1 Rabbit Polyclonal Antibody (HRP)

Product Specifications

Product Name Alternative

Maf, AU042856, 1110068E11Rik

UniProt

Q9D0U6

Clonality

Polyclonal

Conjugation

HRP

Sequence

Synthetic peptide located within the following region: HVLEALSPPQTSGLSPSRLSKSQGGEDESPLSDKCSRKTLFYLIATLNES

Purification

Affinity Purified

Form

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Molecular Weight

28kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Equine, Guinea pig, Human, Mouse, Rat

Tested Applications

WB

NCBI Accession Number

NP_001158079

Host or Source

Rabbit

Preservative

Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FLJ10357 (ARHGEF40) Human siRNA Oligo Duplex (Locus ID 55701)
SR310868 1 Kit

FLJ10357 (ARHGEF40) Human siRNA Oligo Duplex (Locus ID 55701)

Sign In for Pricing
View Details
Screw GB/T9074.4 M3x6 2ea
MIX1360 2 / PCK

Screw GB/T9074.4 M3x6 2ea

Sign In for Pricing
View Details
Olfr569 Mouse qPCR Primer Pair (NM_147088)
MP210022 200 Reactions

Olfr569 Mouse qPCR Primer Pair (NM_147088)

Sign In for Pricing
View Details
Rabbit Polyclonal Calcineurin A Antibody [Alexa Fluor 700]
NB110-40552AF700 0.1 mL

Rabbit Polyclonal Calcineurin A Antibody [Alexa Fluor 700]

Sign In for Pricing
View Details
Recombinant Mycobacterium Leprae ndk Protein (aa 1-136) (strain Br4923)
VAng-Yyj2214-1mgEcoli 1 mg (E. coli)

Recombinant Mycobacterium Leprae ndk Protein (aa 1-136) (strain Br4923)

Sign In for Pricing
View Details
GM11757 Adenovirus (Mouse)
21746054 1.0 mL

GM11757 Adenovirus (Mouse)

Sign In for Pricing
View Details