Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zmat1 Rabbit Polyclonal Antibody (Biotin)

Zmat1 Rabbit Polyclonal Antibody (Biotin)

Product Specifications

Product Name Alternative

AW990744, A230096A06, B930008K04Rik

UniProt

G5E8E4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse Zmat1

Clonality

Polyclonal

Conjugation

Biotin

Sequence

Synthetic peptide located within the following region: HNLPAESKTYDSFQDELEDYIKGQKARGLDPNTSFRRMSESYRYRDQRYR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

76kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_780655

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRP19 (h2) : 293T Lysate
sc-174522 100 µg - 200 µL

PRP19 (h2) : 293T Lysate

Sign In for Pricing
View Details
BRCA2 Rabbit pAb, PerCP conjugated
orb3000825 100 µL

BRCA2 Rabbit pAb, PerCP conjugated

Sign In for Pricing
View Details
Anti-NMI Antibody Picoband® (monoclonal, 2F3), Dylight594 Conjugate
M02768-Dylight594 100 µg

Anti-NMI Antibody Picoband® (monoclonal, 2F3), Dylight594 Conjugate

Sign In for Pricing
View Details
IDO (mIDO-48) Alexa Fluor® 546
sc-53978 AF546 200 µg/mL

IDO (mIDO-48) Alexa Fluor® 546

Sign In for Pricing
View Details
Lentiviral mouse Fes shRNA (UAS) - Lentiviral mouse Fes shRNA (UAS, iRFP) plasmid
GTR15265252 1 Vial

Lentiviral mouse Fes shRNA (UAS) - Lentiviral mouse Fes shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Cre Expressing Monkey Primary Brain Microvascular Endothelial Cells
NHFF-1123-HX107 Each

Cre Expressing Monkey Primary Brain Microvascular Endothelial Cells

Sign In for Pricing
View Details