Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Zmat1 Rabbit Polyclonal Antibody (FITC)

Zmat1 Rabbit Polyclonal Antibody (FITC)

Product Specifications

Product Name Alternative

AW990744, A230096A06, B930008K04Rik

UniProt

G5E8E4

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Mouse Zmat1

Clonality

Polyclonal

Conjugation

FITC

Sequence

Synthetic peptide located within the following region: HNLPAESKTYDSFQDELEDYIKGQKARGLDPNTSFRRMSESYRYRDQRYR

Purification

Affinity Purified

Form

Liquid. Purified antibody supplied in 1x PBS buffer.

Molecular Weight

76kDa

Storage Conditions

All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil) . Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -2°C to -8°C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.

Notes

For research use only.

Prediction Reactivity

Bovine, Canine, Equine, Guinea pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish

Tested Applications

WB

NCBI Accession Number

NP_780655

Host or Source

Rabbit

Preservative

Liquid. Purified antibody supplied in 1x PBS buffer.

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PIP Protein Vector (Human) (pPM-C-HA)
36707022 500 ng

PIP Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
E3 Ligase Ligand-linker Conjugate 114
HY-159661 1 Each

E3 Ligase Ligand-linker Conjugate 114

Sign In for Pricing
View Details
Lentiviral human UBAC1 shRNA (UAS) - Lentiviral human UBAC1 shRNA (UAS, iRFP) plasmid
GTR15082012 1 Vial

Lentiviral human UBAC1 shRNA (UAS) - Lentiviral human UBAC1 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Recombinant Feline NADH-Ubiquinone Oxidoreductase Chain 6 (MT-ND6)
AP2C119-01 1 mg

Recombinant Feline NADH-Ubiquinone Oxidoreductase Chain 6 (MT-ND6)

Sign In for Pricing
View Details
Recombinant Feline NADH-Ubiquinone Oxidoreductase Chain 6 (MT-ND6)
AP2C119-02 100 µg

Recombinant Feline NADH-Ubiquinone Oxidoreductase Chain 6 (MT-ND6)

Sign In for Pricing
View Details
Recombinant Feline NADH-Ubiquinone Oxidoreductase Chain 6 (MT-ND6)
AP2C119-03 20 µg

Recombinant Feline NADH-Ubiquinone Oxidoreductase Chain 6 (MT-ND6)

Sign In for Pricing
View Details